SCOPe 2.03: Domain d2c0fa1: 2c0f A:146-251

Lineage for d2c0fa1 (2c0f A:146-251)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.1: ERP29 C domain-like [47933] (1 family)
   automatically mapped to Pfam PF07749

5. Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins)

6. Protein Windbeutel, C-terminal domain [101269] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries)

8. Domain d2c0fa1: 2c0f A:146-251 [129586]
   Other proteins in same PDB: d2c0fa2, d2c0fb2
   automatically matched to d1ovna1
   mutant

Details for d2c0fa1

PDB Entry: 2c0f, 2.28 Å

PDB Description: Structure of Wind Y53F mutant

PDB Compounds: (A:) windbeutel protein

SCOPe Domain Sequences for d2c0fa1:

Sequence; same for both SEQRES and ATOM records:

>d2c0fa1 a.71.1.1 (A:146-251) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta

Timeline for d2c0fa1:

• d2c0fa1 first appeared in SCOP 1.73
  
• d2c0fa1 appears in SCOPe 2.02
  
• d2c0fa1 appears in SCOPe 2.04
  
• d2c0fa1 appears in the current release, SCOPe 2.08