Class a: All alpha proteins [46456] (284 folds) |
Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
Superfamily a.71.1: ERP29 C domain-like [47933] (1 family) automatically mapped to Pfam PF07749 |
Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins) |
Protein Windbeutel, C-terminal domain [101269] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries) |
Domain d2c0fa1: 2c0f A:146-251 [129586] Other proteins in same PDB: d2c0fa2, d2c0fb2 automatically matched to d1ovna1 mutant |
PDB Entry: 2c0f (more details), 2.28 Å
SCOPe Domain Sequences for d2c0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0fa1 a.71.1.1 (A:146-251) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta
Timeline for d2c0fa1: