Lineage for d2c0fa1 (2c0f A:146-251)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918146Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 918147Superfamily a.71.1: ERP29 C domain-like [47933] (1 family) (S)
  5. 918148Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins)
  6. 918152Protein Windbeutel, C-terminal domain [101269] (1 species)
  7. 918153Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries)
  8. 918158Domain d2c0fa1: 2c0f A:146-251 [129586]
    Other proteins in same PDB: d2c0fa2, d2c0fb2
    automatically matched to d1ovna1
    mutant

Details for d2c0fa1

PDB Entry: 2c0f (more details), 2.28 Å

PDB Description: Structure of Wind Y53F mutant
PDB Compounds: (A:) windbeutel protein

SCOPe Domain Sequences for d2c0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0fa1 a.71.1.1 (A:146-251) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta

SCOPe Domain Coordinates for d2c0fa1:

Click to download the PDB-style file with coordinates for d2c0fa1.
(The format of our PDB-style files is described here.)

Timeline for d2c0fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0fa2