SCOPe 2.03: Domain d2c0eb1: 2c0e B:146-247

Lineage for d2c0eb1 (2c0e B:146-247)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.1: ERP29 C domain-like [47933] (1 family)
   automatically mapped to Pfam PF07749

5. Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins)

6. Protein Windbeutel, C-terminal domain [101269] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries)

8. Domain d2c0eb1: 2c0e B:146-247 [129584]
   Other proteins in same PDB: d2c0ea2, d2c0eb2
   automatically matched to d1ovna1

Details for d2c0eb1

PDB Entry: 2c0e, 2.35 Å

PDB Description: structure of pdi-related chaperone, wind with his-tag on c-terminus.

PDB Compounds: (B:) windbeutel protein

SCOPe Domain Sequences for d2c0eb1:

Sequence; same for both SEQRES and ATOM records:

>d2c0eb1 a.71.1.1 (B:146-247) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkv

Timeline for d2c0eb1:

• d2c0eb1 first appeared in SCOP 1.73
  
• d2c0eb1 appears in SCOPe 2.02
  
• d2c0eb1 appears in SCOPe 2.04
  
• d2c0eb1 appears in the current release, SCOPe 2.08