![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
![]() | Superfamily a.71.1: ERP29 C domain-like [47933] (1 family) ![]() |
![]() | Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins) |
![]() | Protein Windbeutel, C-terminal domain [101269] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries) |
![]() | Domain d2c0eb1: 2c0e B:146-247 [129584] Other proteins in same PDB: d2c0ea2, d2c0eb2 automatically matched to d1ovna1 mutant |
PDB Entry: 2c0e (more details), 2.35 Å
SCOP Domain Sequences for d2c0eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0eb1 a.71.1.1 (B:146-247) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkv
Timeline for d2c0eb1: