Lineage for d2c0ea2 (2c0e A:24-145)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 834281Family c.47.1.7: ERP29 N domain-like [52892] (2 proteins)
  6. 834285Protein Windbeutel, N-terminal domain [102444] (1 species)
  7. 834286Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102445] (5 PDB entries)
  8. 834293Domain d2c0ea2: 2c0e A:24-145 [129583]
    Other proteins in same PDB: d2c0ea1, d2c0eb1
    automatically matched to d1ovnb2
    mutant

Details for d2c0ea2

PDB Entry: 2c0e (more details), 2.35 Å

PDB Description: structure of pdi-related chaperone, wind with his-tag on c-terminus.
PDB Compounds: (A:) windbeutel protein

SCOP Domain Sequences for d2c0ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ea2 c.47.1.7 (A:24-145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv
kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
ig

SCOP Domain Coordinates for d2c0ea2:

Click to download the PDB-style file with coordinates for d2c0ea2.
(The format of our PDB-style files is described here.)

Timeline for d2c0ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0ea1