Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.7: ERP29 N domain-like [52892] (2 proteins) |
Protein Windbeutel, N-terminal domain [102444] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102445] (5 PDB entries) |
Domain d2c0ea2: 2c0e A:24-145 [129583] Other proteins in same PDB: d2c0ea1, d2c0eb1 automatically matched to d1ovnb2 mutant |
PDB Entry: 2c0e (more details), 2.35 Å
SCOP Domain Sequences for d2c0ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ea2 c.47.1.7 (A:24-145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply ig
Timeline for d2c0ea2: