Lineage for d2c0ea1 (2c0e A:146-251)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739455Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 1739456Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) (S)
    automatically mapped to Pfam PF07749
  5. 1739465Family a.71.1.0: automated matches [254218] (1 protein)
    not a true family
  6. 1739466Protein automated matches [254498] (1 species)
    not a true protein
  7. 1739467Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255078] (4 PDB entries)
  8. 1739473Domain d2c0ea1: 2c0e A:146-251 [129582]
    Other proteins in same PDB: d2c0ea2, d2c0eb2
    automated match to d1ovna1

Details for d2c0ea1

PDB Entry: 2c0e (more details), 2.35 Å

PDB Description: structure of pdi-related chaperone, wind with his-tag on c-terminus.
PDB Compounds: (A:) windbeutel protein

SCOPe Domain Sequences for d2c0ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ea1 a.71.1.0 (A:146-251) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta

SCOPe Domain Coordinates for d2c0ea1:

Click to download the PDB-style file with coordinates for d2c0ea1.
(The format of our PDB-style files is described here.)

Timeline for d2c0ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0ea2