![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
![]() | Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) ![]() automatically mapped to Pfam PF07749 |
![]() | Family a.71.1.0: automated matches [254218] (1 protein) not a true family |
![]() | Protein automated matches [254498] (1 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255078] (4 PDB entries) |
![]() | Domain d2c0ea1: 2c0e A:146-251 [129582] Other proteins in same PDB: d2c0ea2, d2c0eb2 automated match to d1ovna1 |
PDB Entry: 2c0e (more details), 2.35 Å
SCOPe Domain Sequences for d2c0ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ea1 a.71.1.0 (A:146-251) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta
Timeline for d2c0ea1: