Lineage for d2c0ac_ (2c0a C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443477Protein KDPG aldolase [51584] (3 species)
  7. 2443478Species Escherichia coli [TaxId:562] [51585] (7 PDB entries)
  8. 2443484Domain d2c0ac_: 2c0a C: [129581]
    automated match to d1euaa_
    complexed with po4

Details for d2c0ac_

PDB Entry: 2c0a (more details), 1.55 Å

PDB Description: mechanism of the class i kdpg aldolase
PDB Compounds: (C:) khg/kdpg aldolase

SCOPe Domain Sequences for d2c0ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ac_ c.1.10.1 (C:) KDPG aldolase {Escherichia coli [TaxId: 562]}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl

SCOPe Domain Coordinates for d2c0ac_:

Click to download the PDB-style file with coordinates for d2c0ac_.
(The format of our PDB-style files is described here.)

Timeline for d2c0ac_: