SCOPe 2.06: Domain d2c0ac_: 2c0a C:

Lineage for d2c0ac_ (2c0a C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein KDPG aldolase [51584] (3 species)

7. Species Escherichia coli [TaxId:562] [51585] (7 PDB entries)

8. Domain d2c0ac_: 2c0a C: [129581]
   automated match to d1euaa_
   complexed with po4

Details for d2c0ac_

PDB Entry: 2c0a, 1.55 Å

PDB Description: mechanism of the class i kdpg aldolase

PDB Compounds: (C:) khg/kdpg aldolase

SCOPe Domain Sequences for d2c0ac_:

Sequence; same for both SEQRES and ATOM records:

>d2c0ac_ c.1.10.1 (C:) KDPG aldolase {Escherichia coli [TaxId: 562]}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl

Timeline for d2c0ac_:

• d2c0ac_ first appeared in SCOP 1.73, called d2c0ac1
  
• d2c0ac_ appears in SCOPe 2.05
  
• d2c0ac_ appears in SCOPe 2.07
  
• d2c0ac_ appears in the current release, SCOPe 2.08