SCOP 1.73: Domain d2c0ac1: 2c0a C:1-213

Lineage for d2c0ac1 (2c0a C:1-213)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein KDPG aldolase [51584] (3 species)

7. Species Escherichia coli [TaxId:562] [51585] (7 PDB entries)

8. Domain d2c0ac1: 2c0a C:1-213 [129581]
   automatically matched to 1WBH A:1-213
   complexed with po4; mutant

Details for d2c0ac1

PDB Entry: 2c0a, 1.55 Å

PDB Description: mechanism of the class i kdpg aldolase

PDB Compounds: (C:) khg/kdpg aldolase

SCOP Domain Sequences for d2c0ac1:

Sequence; same for both SEQRES and ATOM records:

>d2c0ac1 c.1.10.1 (C:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl

Timeline for d2c0ac1:

• d2c0ac1 is new in SCOP 1.73
  
• d2c0ac1 appears in SCOP 1.75
  
• d2c0ac1 appears in the current release, SCOPe 2.08, called d2c0ac_