![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein KDPG aldolase [51584] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [51585] (7 PDB entries) |
![]() | Domain d2c0ac_: 2c0a C: [129581] automated match to d1euaa_ complexed with po4 |
PDB Entry: 2c0a (more details), 1.55 Å
SCOPe Domain Sequences for d2c0ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ac_ c.1.10.1 (C:) KDPG aldolase {Escherichia coli [TaxId: 562]} mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc iggswlvpadaleagdydritklareavegakl
Timeline for d2c0ac_: