| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
| Protein KDPG aldolase [51584] (3 species) |
| Species Escherichia coli [TaxId:562] [51585] (7 PDB entries) |
| Domain d2c0aa1: 2c0a A:1-213 [129579] automatically matched to 1WBH A:1-213 complexed with po4; mutant |
PDB Entry: 2c0a (more details), 1.55 Å
SCOP Domain Sequences for d2c0aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0aa1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl
Timeline for d2c0aa1: