Lineage for d2c08a1 (2c08 A:25-247)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020027Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2020028Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2020029Family a.238.1.1: BAR domain [103658] (4 proteins)
    sensor of membrane curvature
  6. 2020036Protein Endophilin-1 [140699] (3 species)
    SH3-containing GRB2-like protein 2
  7. 2020044Species Norway rat (Rattus norvegicus) [TaxId:10116] [140700] (1 PDB entry)
    Uniprot Q62420 25-247
    UniProt sequence of Rat species, O35179, is a fragment that does not cover the entire domain
  8. 2020045Domain d2c08a1: 2c08 A:25-247 [129578]

Details for d2c08a1

PDB Entry: 2c08 (more details), 2.9 Å

PDB Description: rat endophilin a1 bar domain
PDB Compounds: (A:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d2c08a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c08a1 a.238.1.1 (A:25-247) Endophilin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
egtkldddfkemerkvdvtsravmeimtktieylqpnpasrakpqaeallaeamlkfgre
lgddcnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkkleg
rrldfdykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaql
eyhkqavqilqqvtvrleerirqa

SCOPe Domain Coordinates for d2c08a1:

Click to download the PDB-style file with coordinates for d2c08a1.
(The format of our PDB-style files is described here.)

Timeline for d2c08a1: