SCOP 1.75: Domain d2c08a1: 2c08 A:25-247

Lineage for d2c08a1 (2c08 A:25-247)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (4 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.1: BAR domain [103658] (3 proteins)
   sensor of membrane curvature

6. Protein Endophilin-1 [140699] (3 species)
   SH3-containing GRB2-like protein 2

7. Species Rat (Rattus norvegicus) [TaxId:10116] [140700] (1 PDB entry)
   Uniprot Q62420 25-247
   UniProt sequence of Rat species, O35179, is a fragment that does not cover the entire domain

8. Domain d2c08a1: 2c08 A:25-247 [129578]

Details for d2c08a1

PDB Entry: 2c08, 2.9 Å

PDB Description: rat endophilin a1 bar domain

PDB Compounds: (A:) sh3-containing grb2-like protein 2

SCOP Domain Sequences for d2c08a1:

Sequence; same for both SEQRES and ATOM records:

>d2c08a1 a.238.1.1 (A:25-247) Endophilin-1 {Rat (Rattus norvegicus) [TaxId: 10116]}
egtkldddfkemerkvdvtsravmeimtktieylqpnpasrakpqaeallaeamlkfgre
lgddcnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkkleg
rrldfdykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaql
eyhkqavqilqqvtvrleerirqa

Timeline for d2c08a1:

• d2c08a1 first appeared in SCOP 1.73
  
• d2c08a1 appears in SCOPe 2.01
  
• d2c08a1 appears in the current release, SCOPe 2.08