SCOP 1.73: Domain d2c06b1: 2c06 B:1-110

Lineage for d2c06b1 (2c06 B:1-110)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (3 proteins)

6. Protein Kid toxin protein (ParD) [82076] (1 species)

7. Species Plasmid R1, from Escherichia coli [TaxId:2482] [82077] (2 PDB entries)

8. Domain d2c06b1: 2c06 B:1-110 [129576]
   automatically matched to d1m1fa_

Details for d2c06b1

PDB Entry: 2c06

PDB Description: nmr-based model of the complex of the toxin kid and a 5-nucleotide substrate rna fragment (auaca)

PDB Compounds: (B:) kid toxin protein

SCOP Domain Sequences for d2c06b1:

Sequence; same for both SEQRES and ATOM records:

>d2c06b1 b.34.6.2 (B:1-110) Kid toxin protein (ParD) {Plasmid R1, from Escherichia coli [TaxId: 2482]}
mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsggnfartagfavs
ldgvgirttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt

Timeline for d2c06b1:

• d2c06b1 is new in SCOP 1.73
  
• d2c06b1 appears in SCOP 1.75
  
• d2c06b1 appears in the current release, SCOPe 2.08