Lineage for d2c05a_ (2c05 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635083Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1635084Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1635085Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1635161Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 1635162Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)
  8. 1635168Domain d2c05a_: 2c05 A: [129574]
    automated match to d1gqva_
    protein/RNA complex; complexed with acy, b4p

Details for d2c05a_

PDB Entry: 2c05 (more details), 1.86 Å

PDB Description: crystal structures of eosinophil-derived neurotoxin in complex with the inhibitors 5'-atp, ap3a, ap4a and ap5a
PDB Compounds: (A:) nonsecretory ribonuclease

SCOPe Domain Sequences for d2c05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c05a_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOPe Domain Coordinates for d2c05a_:

Click to download the PDB-style file with coordinates for d2c05a_.
(The format of our PDB-style files is described here.)

Timeline for d2c05a_: