SCOP 1.73: Domain d2c05a1: 2c05 A:0-134

Lineage for d2c05a1 (2c05 A:0-134)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)

8. Domain d2c05a1: 2c05 A:0-134 [129574]
   automatically matched to d1gqva_
   complexed with acy, b4p

Details for d2c05a1

PDB Entry: 2c05, 1.86 Å

PDB Description: crystal structures of eosinophil-derived neurotoxin in complex with the inhibitors 5'-atp, ap3a, ap4a and ap5a

PDB Compounds: (A:) nonsecretory ribonuclease

SCOP Domain Sequences for d2c05a1:

Sequence; same for both SEQRES and ATOM records:

>d2c05a1 d.5.1.1 (A:0-134) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

Timeline for d2c05a1:

• d2c05a1 is new in SCOP 1.73
  
• d2c05a1 appears in SCOP 1.75
  
• d2c05a1 appears in the current release, SCOPe 2.08, called d2c05a2