Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (1 family) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries) |
Domain d2c05a1: 2c05 A:0-134 [129574] automatically matched to d1gqva_ complexed with acy, b4p |
PDB Entry: 2c05 (more details), 1.86 Å
SCOP Domain Sequences for d2c05a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c05a1 d.5.1.1 (A:0-134) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]} mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd ppqypvvpvhldrii
Timeline for d2c05a1: