SCOPe 2.05: Domain d2c04b2: 2c04 B:89-296

Lineage for d2c04b2 (2c04 B:89-296)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (17 PDB entries)

8. Domain d2c04b2: 2c04 B:89-296 [129573]
   Other proteins in same PDB: d2c04a1, d2c04b1
   automated match to d1o87a2
   protein/RNA complex; complexed with ca, gcp

Details for d2c04b2

PDB Entry: 2c04, 1.15 Å

PDB Description: gmppcp complex of srp gtpase ffh ng domain at ultra-high resolution

PDB Compounds: (B:) signal recognition particle protein

SCOPe Domain Sequences for d2c04b2:

Sequence; same for both SEQRES and ATOM records:

>d2c04b2 c.37.1.10 (B:89-296) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgd

Timeline for d2c04b2:

• d2c04b2 first appeared in SCOP 1.73
  
• d2c04b2 appears in SCOPe 2.04
  
• d2c04b2 appears in SCOPe 2.06
  
• d2c04b2 appears in the current release, SCOPe 2.08