SCOPe 2.08: Domain d2c04b1: 2c04 B:1-88

Lineage for d2c04b1 (2c04 B:1-88)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries)

8. Domain d2c04b1: 2c04 B:1-88 [129572]
   Other proteins in same PDB: d2c04a2, d2c04b2
   automated match to d1o87a1
   protein/RNA complex; complexed with ca, gcp

Details for d2c04b1

PDB Entry: 2c04, 1.15 Å

PDB Description: gmppcp complex of srp gtpase ffh ng domain at ultra-high resolution

PDB Compounds: (B:) signal recognition particle protein

SCOPe Domain Sequences for d2c04b1:

Sequence; same for both SEQRES and ATOM records:

>d2c04b1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d2c04b1:

• d2c04b1 first appeared in SCOP 1.73
  
• d2c04b1 appears in SCOPe 2.07