Class a: All alpha proteins [46456] (258 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) |
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
Protein Signal sequence recognition protein Ffh [47366] (3 species) |
Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries) |
Domain d2c04a1: 2c04 A:1-88 [129570] Other proteins in same PDB: d2c04a2, d2c04b2 automatically matched to d2ffha1 complexed with ca, gcp |
PDB Entry: 2c04 (more details), 1.15 Å
SCOP Domain Sequences for d2c04a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c04a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal gkqvlesltpaevilatvyealkealgg
Timeline for d2c04a1: