Lineage for d2c03b2 (2c03 B:89-297)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869314Protein automated matches [190304] (16 species)
    not a true protein
  7. 2869413Species Thermus aquaticus [TaxId:271] [255076] (4 PDB entries)
  8. 2869415Domain d2c03b2: 2c03 B:89-297 [129569]
    Other proteins in same PDB: d2c03a1, d2c03b1
    automated match to d2ffha3
    protein/RNA complex; complexed with dio, edo, gdp

Details for d2c03b2

PDB Entry: 2c03 (more details), 1.24 Å

PDB Description: gdp complex of srp gtpase ffh ng domain
PDB Compounds: (B:) signal recognition particle protein

SCOPe Domain Sequences for d2c03b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c03b2 c.37.1.10 (B:89-297) automated matches {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdv

SCOPe Domain Coordinates for d2c03b2:

Click to download the PDB-style file with coordinates for d2c03b2.
(The format of our PDB-style files is described here.)

Timeline for d2c03b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c03b1