Lineage for d2c03b1 (2c03 B:1-88)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311976Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2312032Family a.24.13.0: automated matches [229049] (1 protein)
    not a true family
  6. 2312033Protein automated matches [229050] (6 species)
    not a true protein
  7. 2312046Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries)
  8. 2312048Domain d2c03b1: 2c03 B:1-88 [129568]
    Other proteins in same PDB: d2c03a2, d2c03b2
    automated match to d2c03b1
    protein/RNA complex; complexed with dio, edo, gdp

Details for d2c03b1

PDB Entry: 2c03 (more details), 1.24 Å

PDB Description: gdp complex of srp gtpase ffh ng domain
PDB Compounds: (B:) signal recognition particle protein

SCOPe Domain Sequences for d2c03b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c03b1 a.24.13.0 (B:1-88) automated matches {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOPe Domain Coordinates for d2c03b1:

Click to download the PDB-style file with coordinates for d2c03b1.
(The format of our PDB-style files is described here.)

Timeline for d2c03b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c03b2