Lineage for d2c03a2 (2c03 A:89-295)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364310Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1364444Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 1364455Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries)
  8. 1364463Domain d2c03a2: 2c03 A:89-295 [129567]
    Other proteins in same PDB: d2c03a1, d2c03b1
    automatically matched to d2ffha3
    protein/RNA complex; complexed with dio, edo, gdp

Details for d2c03a2

PDB Entry: 2c03 (more details), 1.24 Å

PDB Description: gdp complex of srp gtpase ffh ng domain
PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2c03a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c03a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

SCOPe Domain Coordinates for d2c03a2:

Click to download the PDB-style file with coordinates for d2c03a2.
(The format of our PDB-style files is described here.)

Timeline for d2c03a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c03a1