SCOPe 2.08: Domain d2c03a1: 2c03 A:1-88

Lineage for d2c03a1 (2c03 A:1-88)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.0: automated matches [229049] (1 protein)
   not a true family

6. Protein automated matches [229050] (7 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries)

8. Domain d2c03a1: 2c03 A:1-88 [129566]
   Other proteins in same PDB: d2c03a2, d2c03b2
   automated match to d2c03a1
   protein/RNA complex; complexed with dio, edo, gdp

Details for d2c03a1

PDB Entry: 2c03, 1.24 Å

PDB Description: gdp complex of srp gtpase ffh ng domain

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2c03a1:

Sequence; same for both SEQRES and ATOM records:

>d2c03a1 a.24.13.0 (A:1-88) automated matches {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d2c03a1:

• d2c03a1 first appeared in SCOP 1.73
  
• d2c03a1 appears in SCOPe 2.07