Lineage for d2c02a2 (2c02 A:1-134)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928121Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 2928122Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)
  8. 2928129Domain d2c02a2: 2c02 A:1-134 [129565]
    Other proteins in same PDB: d2c02a3
    automated match to d1gqva_
    protein/RNA complex; complexed with acy, adp

Details for d2c02a2

PDB Entry: 2c02 (more details), 2 Å

PDB Description: crystal structures of eosinophil-derived neurotoxin in complex with the inhibitors 5'-atp, ap3a, ap4a and ap5a
PDB Compounds: (A:) nonsecretory ribonuclease

SCOPe Domain Sequences for d2c02a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c02a2 d.5.1.1 (A:1-134) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
kppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpnm
tcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrdp
pqypvvpvhldrii

SCOPe Domain Coordinates for d2c02a2:

Click to download the PDB-style file with coordinates for d2c02a2.
(The format of our PDB-style files is described here.)

Timeline for d2c02a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c02a3