SCOPe 2.05: Domain d2c01x_: 2c01 X:

Lineage for d2c01x_ (2c01 X:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)

8. Domain d2c01x_: 2c01 X: [129564]
   automated match to d1gqva_
   protein/RNA complex; complexed with acy, atp

Details for d2c01x_

PDB Entry: 2c01, 1.24 Å

PDB Description: crystal structures of eosinophil-derived neurotoxin in complex with the inhibitors 5'-atp, ap3a, ap4a and ap5a

PDB Compounds: (X:) nonsecretory ribonuclease

SCOPe Domain Sequences for d2c01x_:

Sequence; same for both SEQRES and ATOM records:

>d2c01x_ d.5.1.1 (X:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

Timeline for d2c01x_:

• d2c01x_ first appeared in SCOP 1.73, called d2c01x1
  
• d2c01x_ appears in SCOPe 2.04
  
• d2c01x_ is called d2c01x2 in SCOPe 2.06
  
• d2c01x_ appears in the current release, SCOPe 2.08, called d2c01x2