Lineage for d2c01x_ (2c01 X:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890136Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 1890137Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)
  8. 1890141Domain d2c01x_: 2c01 X: [129564]
    automated match to d1gqva_
    protein/RNA complex; complexed with acy, atp

Details for d2c01x_

PDB Entry: 2c01 (more details), 1.24 Å

PDB Description: crystal structures of eosinophil-derived neurotoxin in complex with the inhibitors 5'-atp, ap3a, ap4a and ap5a
PDB Compounds: (X:) nonsecretory ribonuclease

SCOPe Domain Sequences for d2c01x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c01x_ d.5.1.1 (X:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOPe Domain Coordinates for d2c01x_:

Click to download the PDB-style file with coordinates for d2c01x_.
(The format of our PDB-style files is described here.)

Timeline for d2c01x_: