Lineage for d2bzwa2 (2bzw A:27-197)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021485Protein automated matches [190236] (3 species)
    not a true protein
  7. 3021537Species Mouse (Mus musculus) [TaxId:10090] [187004] (1 PDB entry)
  8. 3021538Domain d2bzwa2: 2bzw A:27-197 [129562]
    Other proteins in same PDB: d2bzwa3
    automated match to d1lxl__

Details for d2bzwa2

PDB Entry: 2bzw (more details), 2.3 Å

PDB Description: the crystal structure of bcl-xl in complex with full-length bad
PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2bzwa2:

Sequence, based on SEQRES records: (download)

>d2bzwa2 f.1.4.1 (A:27-197) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fsdveenrteapeeteaeretpsaingnpswhladspavngatghsssldarevipmaav
kqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsf
ggalcvesvdkemqvlvsriaswmatylndhlepwiqenggwdtfvdlygn

Sequence, based on observed residues (ATOM records): (download)

>d2bzwa2 f.1.4.1 (A:27-197) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fsdipmaavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnw
grivaffsfggalcvesvdkemqvlvsriaswmatylndhlepwiqenggwdtfvdlygn

SCOPe Domain Coordinates for d2bzwa2:

Click to download the PDB-style file with coordinates for d2bzwa2.
(The format of our PDB-style files is described here.)

Timeline for d2bzwa2: