![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein automated matches [190236] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187004] (1 PDB entry) |
![]() | Domain d2bzwa2: 2bzw A:27-197 [129562] Other proteins in same PDB: d2bzwa3 automated match to d1lxl__ |
PDB Entry: 2bzw (more details), 2.3 Å
SCOPe Domain Sequences for d2bzwa2:
Sequence, based on SEQRES records: (download)
>d2bzwa2 f.1.4.1 (A:27-197) automated matches {Mouse (Mus musculus) [TaxId: 10090]} fsdveenrteapeeteaeretpsaingnpswhladspavngatghsssldarevipmaav kqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsf ggalcvesvdkemqvlvsriaswmatylndhlepwiqenggwdtfvdlygn
>d2bzwa2 f.1.4.1 (A:27-197) automated matches {Mouse (Mus musculus) [TaxId: 10090]} fsdipmaavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnw grivaffsfggalcvesvdkemqvlvsriaswmatylndhlepwiqenggwdtfvdlygn
Timeline for d2bzwa2: