SCOPe 2.08: Domain d2bzwa2: 2bzw A:27-197

Lineage for d2bzwa2 (2bzw A:27-197)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187004] (1 PDB entry)

8. Domain d2bzwa2: 2bzw A:27-197 [129562]
   Other proteins in same PDB: d2bzwa3
   automated match to d1lxl__

Details for d2bzwa2

PDB Entry: 2bzw, 2.3 Å

PDB Description: the crystal structure of bcl-xl in complex with full-length bad

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2bzwa2:

Sequence, based on SEQRES records:

>d2bzwa2 f.1.4.1 (A:27-197) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fsdveenrteapeeteaeretpsaingnpswhladspavngatghsssldarevipmaav
kqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsf
ggalcvesvdkemqvlvsriaswmatylndhlepwiqenggwdtfvdlygn

Sequence, based on observed residues (ATOM records):

>d2bzwa2 f.1.4.1 (A:27-197) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fsdipmaavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnw
grivaffsfggalcvesvdkemqvlvsriaswmatylndhlepwiqenggwdtfvdlygn

Timeline for d2bzwa2:

• d2bzwa2 first appeared in SCOP 1.73, called d2bzwa1
  
• d2bzwa2 was called d2bzwa_ in SCOPe 2.07