SCOPe 2.08: Domain d2bzsb_: 2bzs B:

Lineage for d2bzsb_ (2bzs B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein automated matches [190235] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187003] (4 PDB entries)

8. Domain d2bzsb_: 2bzs B: [129561]
   automated match to d1qr2a_
   complexed with cb1, fad, zn

Details for d2bzsb_

PDB Entry: 2bzs, 2 Å

PDB Description: binding of anti-cancer prodrug cb1954 to the activating enzyme nqo2 revealed by the crystal structure of their complex.

PDB Compounds: (B:) nrh dehydrogenase [quinone] 2

SCOPe Domain Sequences for d2bzsb_:

Sequence; same for both SEQRES and ATOM records:

>d2bzsb_ c.23.5.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

Timeline for d2bzsb_:

• d2bzsb_ first appeared in SCOP 1.73, called d2bzsb1
  
• d2bzsb_ appears in SCOPe 2.07