Lineage for d2bzsa_ (2bzs A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464786Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2464991Protein automated matches [190235] (2 species)
    not a true protein
  7. 2464992Species Human (Homo sapiens) [TaxId:9606] [187003] (8 PDB entries)
  8. 2464993Domain d2bzsa_: 2bzs A: [129560]
    automated match to d1qr2a_
    complexed with cb1, fad, zn

Details for d2bzsa_

PDB Entry: 2bzs (more details), 2 Å

PDB Description: binding of anti-cancer prodrug cb1954 to the activating enzyme nqo2 revealed by the crystal structure of their complex.
PDB Compounds: (A:) nrh dehydrogenase [quinone] 2

SCOPe Domain Sequences for d2bzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzsa_ c.23.5.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOPe Domain Coordinates for d2bzsa_:

Click to download the PDB-style file with coordinates for d2bzsa_.
(The format of our PDB-style files is described here.)

Timeline for d2bzsa_: