Lineage for d2bzbb2 (2bzb B:1-54)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322230Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2322350Superfamily a.30.7: BAS1536-like [140500] (1 family) (S)
    automatically mapped to Pfam PF09388
  5. 2322351Family a.30.7.1: BAS1536-like [140501] (3 proteins)
    PfamB PB015565
  6. 2322358Protein automated matches [254494] (1 species)
    not a true protein
  7. 2322359Species Bacillus anthracis [TaxId:198094] [255070] (1 PDB entry)
  8. 2322360Domain d2bzbb2: 2bzb B:1-54 [129557]
    Other proteins in same PDB: d2bzba1, d2bzba2, d2bzbb3
    automated match to d2bzba1

Details for d2bzbb2

PDB Entry: 2bzb (more details)

PDB Description: nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
PDB Compounds: (B:) conserved domain protein

SCOPe Domain Sequences for d2bzbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzbb2 a.30.7.1 (B:1-54) automated matches {Bacillus anthracis [TaxId: 198094]}
memgqlknkienkkkeliqlvarhgldhdkvllfsrdldklinkfmnvkdkvhk

SCOPe Domain Coordinates for d2bzbb2:

Click to download the PDB-style file with coordinates for d2bzbb2.
(The format of our PDB-style files is described here.)

Timeline for d2bzbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bzbb3