![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.7: BAS1536-like [140500] (1 family) ![]() automatically mapped to Pfam PF09388 |
![]() | Family a.30.7.1: BAS1536-like [140501] (3 proteins) PfamB PB015565 |
![]() | Protein automated matches [254494] (1 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:198094] [255070] (1 PDB entry) |
![]() | Domain d2bzbb2: 2bzb B:1-54 [129557] Other proteins in same PDB: d2bzba1, d2bzba2, d2bzbb3 automated match to d2bzba1 |
PDB Entry: 2bzb (more details)
SCOPe Domain Sequences for d2bzbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzbb2 a.30.7.1 (B:1-54) automated matches {Bacillus anthracis [TaxId: 198094]} memgqlknkienkkkeliqlvarhgldhdkvllfsrdldklinkfmnvkdkvhk
Timeline for d2bzbb2: