SCOPe 2.08: Domain d2bzbb2: 2bzb B:1-54

Lineage for d2bzbb2 (2bzb B:1-54)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.7: BAS1536-like [140500] (1 family)
   automatically mapped to Pfam PF09388

5. Family a.30.7.1: BAS1536-like [140501] (3 proteins)
   PfamB PB015565

6. Protein automated matches [254494] (1 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [255070] (1 PDB entry)

8. Domain d2bzbb2: 2bzb B:1-54 [129557]
   Other proteins in same PDB: d2bzba1, d2bzba2, d2bzbb3
   automated match to d2bzba1

Details for d2bzbb2

PDB Entry: 2bzb

PDB Description: nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis

PDB Compounds: (B:) conserved domain protein

SCOPe Domain Sequences for d2bzbb2:

Sequence; same for both SEQRES and ATOM records:

>d2bzbb2 a.30.7.1 (B:1-54) automated matches {Bacillus anthracis [TaxId: 198094]}
memgqlknkienkkkeliqlvarhgldhdkvllfsrdldklinkfmnvkdkvhk

Timeline for d2bzbb2:

• d2bzbb2 first appeared in SCOP 1.73, called d2bzbb1
  
• d2bzbb2 appears in SCOPe 2.07