Lineage for d2bzba1 (2bzb A:1-54)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322230Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2322350Superfamily a.30.7: BAS1536-like [140500] (1 family) (S)
    automatically mapped to Pfam PF09388
  5. 2322351Family a.30.7.1: BAS1536-like [140501] (3 proteins)
    PfamB PB015565
  6. 2322352Protein Hypothetical protein BAS1536 [140502] (1 species)
  7. 2322353Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [140503] (1 PDB entry)
    Uniprot Q81SJ3 19-72
  8. 2322354Domain d2bzba1: 2bzb A:1-54 [129556]
    Other proteins in same PDB: d2bzba2, d2bzbb2, d2bzbb3

Details for d2bzba1

PDB Entry: 2bzb (more details)

PDB Description: nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
PDB Compounds: (A:) conserved domain protein

SCOPe Domain Sequences for d2bzba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzba1 a.30.7.1 (A:1-54) Hypothetical protein BAS1536 {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
memgqlknkienkkkeliqlvarhgldhdkvllfsrdldklinkfmnvkdkvhk

SCOPe Domain Coordinates for d2bzba1:

Click to download the PDB-style file with coordinates for d2bzba1.
(The format of our PDB-style files is described here.)

Timeline for d2bzba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bzba2