SCOPe 2.06: Domain d2bzba1: 2bzb A:1-54

Lineage for d2bzba1 (2bzb A:1-54)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.7: BAS1536-like [140500] (1 family)
   automatically mapped to Pfam PF09388

5. Family a.30.7.1: BAS1536-like [140501] (3 proteins)
   PfamB PB015565

6. Protein Hypothetical protein BAS1536 [140502] (1 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [140503] (1 PDB entry)
   Uniprot Q81SJ3 19-72

8. Domain d2bzba1: 2bzb A:1-54 [129556]
   Other proteins in same PDB: d2bzba2, d2bzbb2, d2bzbb3

Details for d2bzba1

PDB Entry: 2bzb

PDB Description: nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis

PDB Compounds: (A:) conserved domain protein

SCOPe Domain Sequences for d2bzba1:

Sequence; same for both SEQRES and ATOM records:

>d2bzba1 a.30.7.1 (A:1-54) Hypothetical protein BAS1536 {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
memgqlknkienkkkeliqlvarhgldhdkvllfsrdldklinkfmnvkdkvhk

Timeline for d2bzba1:

• d2bzba1 first appeared in SCOP 1.73
  
• d2bzba1 appears in SCOPe 2.05
  
• d2bzba1 appears in SCOPe 2.07
  
• d2bzba1 appears in the current release, SCOPe 2.08