Lineage for d2bz9b1 (2bz9 B:2-449)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646381Protein Cytochrome p450 14 alpha-sterol demethylase (cyp51) [48276] (1 species)
  7. 646382Species Mycobacterium tuberculosis [TaxId:1773] [48277] (6 PDB entries)
  8. 646389Domain d2bz9b1: 2bz9 B:2-449 [129555]
    automatically matched to d1x8va_
    complexed with hem; mutant

Details for d2bz9b1

PDB Entry: 2bz9 (more details), 2.21 Å

PDB Description: ligand-free structure of sterol 14alpha-demethylase from mycobacterium tuberculosis in p2(1) space group
PDB Compounds: (B:) sterol 14alpha-demethylase

SCOP Domain Sequences for d2bz9b1:

Sequence, based on SEQRES records: (download)

>d2bz9b1 a.104.1.1 (B:2-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d2bz9b1 a.104.1.1 (B:2-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
rrrdearnglvalvadimngrianpdrdmldvliavkaetgtprfsadeitgmfismmfa
ghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlr
lhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqe
dllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvq
laqpaavryrrrt

SCOP Domain Coordinates for d2bz9b1:

Click to download the PDB-style file with coordinates for d2bz9b1.
(The format of our PDB-style files is described here.)

Timeline for d2bz9b1: