Lineage for d2bz9b_ (2bz9 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein automated matches [190068] (12 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:1773] [187002] (1 PDB entry)
  8. Domain d2bz9b_: 2bz9 B: [129555]
    automated match to d1e9xa_
    complexed with hem

Details for d2bz9b_

PDB Entry: 2bz9 (more details), 2.21 Å

PDB Description: ligand-free structure of sterol 14alpha-demethylase from mycobacterium tuberculosis in p2(1) space group
PDB Compounds: (B:) sterol 14alpha-demethylase

SCOPe Domain Sequences for d2bz9b_:

Sequence, based on SEQRES records: (download)

>d2bz9b_ a.104.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d2bz9b_ a.104.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
rrrdearnglvalvadimngrianpdrdmldvliavkaetgtprfsadeitgmfismmfa
ghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlr
lhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqe
dllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvq
laqpaavryrrrt

SCOPe Domain Coordinates for d2bz9b_ are not available.

Timeline for d2bz9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bz9a_