SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bz9b_ (2bz9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005491Species Mycobacterium tuberculosis [TaxId:1773] [187002] (1 PDB entry)
  8. 2005493Domain d2bz9b_: 2bz9 B: [129555]
    automated match to d1e9xa_
    complexed with hem

Details for d2bz9b_

PDB Entry: 2bz9 (more details), 2.21 Å

PDB Description: ligand-free structure of sterol 14alpha-demethylase from mycobacterium tuberculosis in p2(1) space group
PDB Compounds: (B:) sterol 14alpha-demethylase

SCOPe Domain Sequences for d2bz9b_:

Sequence, based on SEQRES records: (download)

>d2bz9b_ a.104.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d2bz9b_ a.104.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
rrrdearnglvalvadimngrianpdrdmldvliavkaetgtprfsadeitgmfismmfa
ghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlr
lhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqe
dllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvq
laqpaavryrrrt

SCOPe Domain Coordinates for d2bz9b_:

Click to download the PDB-style file with coordinates for d2bz9b_.
(The format of our PDB-style files is described here.)

Timeline for d2bz9b_: