Lineage for d2bz9a_ (2bz9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005491Species Mycobacterium tuberculosis [TaxId:1773] [187002] (1 PDB entry)
  8. 2005492Domain d2bz9a_: 2bz9 A: [129554]
    automated match to d1e9xa_
    complexed with hem

Details for d2bz9a_

PDB Entry: 2bz9 (more details), 2.21 Å

PDB Description: ligand-free structure of sterol 14alpha-demethylase from mycobacterium tuberculosis in p2(1) space group
PDB Compounds: (A:) sterol 14alpha-demethylase

SCOPe Domain Sequences for d2bz9a_:

Sequence, based on SEQRES records: (download)

>d2bz9a_ a.104.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d2bz9a_ a.104.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgmlhnaalrgeqmkghaatiedqvrrmiadwgeageid
lldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesfrrrd
earnglvalvadimngrianpsdrdmldvliavkaetgtprfsadeitgmfismmfaghh
tssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhp
pliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedll
nrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaq
paavryrrrt

SCOPe Domain Coordinates for d2bz9a_:

Click to download the PDB-style file with coordinates for d2bz9a_.
(The format of our PDB-style files is described here.)

Timeline for d2bz9a_: