Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein automated matches [190092] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries) |
Domain d2bz6l_: 2bz6 L: [129553] Other proteins in same PDB: d2bz6h_ automated match to d1klil_ complexed with 346, ca, so4 |
PDB Entry: 2bz6 (more details), 1.6 Å
SCOPe Domain Sequences for d2bz6l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bz6l_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]} icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d2bz6l_: