SCOP 1.73: Domain d2bz6l1: 2bz6 L:90-142

Lineage for d2bz6l1 (2bz6 L:90-142)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)

8. Domain d2bz6l1: 2bz6 L:90-142 [129553]
   Other proteins in same PDB: d2bz6h1
   automatically matched to d1klil_
   complexed with 346, ca, so4

Details for d2bz6l1

PDB Entry: 2bz6, 1.6 Å

PDB Description: orally available factor7a inhibitor

PDB Compounds: (L:) blood coagulation factor viia

SCOP Domain Sequences for d2bz6l1:

Sequence; same for both SEQRES and ATOM records:

>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d2bz6l1:

• d2bz6l1 is new in SCOP 1.73
  
• d2bz6l1 appears in SCOP 1.75
  
• d2bz6l1 appears in the current release, SCOPe 2.08, called d2bz6l_