Lineage for d2bz5a1 (2bz5 A:16-223)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) 
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein) Protein HSP90 [55876] (3 species) Species Human (Homo sapiens) [TaxId:9606] [55878] (35 PDB entries) 
Domain d2bz5a1: 2bz5 A:16-223 [129550]
automatically matched to d1osfa_
complexed with ab4
Details for d2bz5a1
PDB Entry: 2bz5 (more details), 1.9 Å
PDB Description: structure-based discovery of a new class of hsp90 inhibitors
PDB Compounds: (A:) heat shock protein hsp90-alphaSCOP Domain Sequences for d2bz5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bz5a1 d.122.1.1 (A:16-223) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve
SCOP Domain Coordinates for d2bz5a1:
Click to download the PDB-style file with coordinates for d2bz5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bz5a1:
- d2bz5a1 is new in SCOP 1.73
- d2bz5a1 appears in SCOP 1.75
- d2bz5a1 appears in the current release, SCOPe 2.08, called d2bz5a_
View in 3D
