![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (45 species) not a true protein |
![]() | Domain d2bz4c2: 2bz4 C:254-406 [129547] Other proteins in same PDB: d2bz4a1, d2bz4b1, d2bz4c1, d2bz4d1 automated match to d1ek4a2 complexed with nh4, so4; mutant |
PDB Entry: 2bz4 (more details), 1.86 Å
SCOPe Domain Sequences for d2bz4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bz4c2 c.95.1.0 (C:254-406) automated matches {Escherichia coli [TaxId: 562]} yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgtstpvgdvkelaai revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni vtettdrelttvmsnsfgfggtnatlvmrklkd
Timeline for d2bz4c2: