Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Escherichia coli [TaxId:562] [254878] (9 PDB entries) |
Domain d2bz3b2: 2bz3 B:254-406 [129537] Other proteins in same PDB: d2bz3a1, d2bz3b1, d2bz3c1, d2bz3d1 automated match to d1ek4a2 complexed with dao, nh4, so4; mutant |
PDB Entry: 2bz3 (more details), 2 Å
SCOPe Domain Sequences for d2bz3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bz3b2 c.95.1.0 (B:254-406) automated matches {Escherichia coli [TaxId: 562]} yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsegtstpvgdvkelaai revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni vtettdrelttvmsnsfgfggtnatlvmrklkd
Timeline for d2bz3b2: