Lineage for d2bz3a2 (2bz3 A:254-406)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711305Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 711326Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 711327Species Escherichia coli [TaxId:562] [53908] (19 PDB entries)
  8. 711385Domain d2bz3a2: 2bz3 A:254-406 [129535]
    automatically matched to d1dd8a2
    complexed with dao, nh4, so4; mutant

Details for d2bz3a2

PDB Entry: 2bz3 (more details), 2 Å

PDB Description: structure of e.coli kas i h298e mutant in complex with c12 fatty acid
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOP Domain Sequences for d2bz3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bz3a2 c.95.1.1 (A:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsegtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOP Domain Coordinates for d2bz3a2:

Click to download the PDB-style file with coordinates for d2bz3a2.
(The format of our PDB-style files is described here.)

Timeline for d2bz3a2: