Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Negative elongation factor E, NELF-E [143302] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143303] (3 PDB entries) Uniprot P18615 257-335! Uniprot P18615 258-341 |
Domain d2bz2a1: 2bz2 A:35-113 [129533] |
PDB Entry: 2bz2 (more details)
SCOPe Domain Sequences for d2bz2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} aprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqavaeln gtqvesvqlkvniarkqpm
Timeline for d2bz2a1: