Lineage for d2bz2a1 (2bz2 A:35-113)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195161Protein Negative elongation factor E, NELF-E [143302] (1 species)
  7. 2195162Species Human (Homo sapiens) [TaxId:9606] [143303] (3 PDB entries)
    Uniprot P18615 257-335! Uniprot P18615 258-341
  8. 2195163Domain d2bz2a1: 2bz2 A:35-113 [129533]

Details for d2bz2a1

PDB Entry: 2bz2 (more details)

PDB Description: solution structure of nelf e rrm
PDB Compounds: (A:) negative elongation factor e

SCOPe Domain Sequences for d2bz2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}
aprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqavaeln
gtqvesvqlkvniarkqpm

SCOPe Domain Coordinates for d2bz2a1:

Click to download the PDB-style file with coordinates for d2bz2a1.
(The format of our PDB-style files is described here.)

Timeline for d2bz2a1: