![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.144: RibA-like [142694] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 1235467, strands 1 and 3 are antiparallel to the rest; partial topological similarity to some alpha/beta hydrolases (53473) |
![]() | Superfamily c.144.1: RibA-like [142695] (2 families) ![]() automatically mapped to Pfam PF00925 |
![]() | Family c.144.1.1: RibA-like [142696] (1 protein) Pfam PF00925; GTP cyclohydrolase II |
![]() | Protein GTP cyclohydrolase II, RibA [142697] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142698] (2 PDB entries) Uniprot P0A7I7 1-174 |
![]() | Domain d2bz1a_: 2bz1 A: [129532] automated match to d2bz0a1 complexed with gol, so4, tau, zn |
PDB Entry: 2bz1 (more details), 1.54 Å
SCOPe Domain Sequences for d2bz1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bz1a_ c.144.1.1 (A:) GTP cyclohydrolase II, RibA {Escherichia coli [TaxId: 562]} mqlkrvaeaklptpwgdflmvgfeelatghdhvalvygdisghtpvlarvhsecltgdal fslrcdcgfqleaaltqiaeegrgillyhrqegrnigllnkirayalqdqgydtveanhq lgfaaderdftlcadmfkllgvnevrlltnnpkkveilteaginivervplivg
Timeline for d2bz1a_: