Lineage for d2bz0b_ (2bz0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923604Fold c.144: RibA-like [142694] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 1235467, strands 1 and 3 are antiparallel to the rest; partial topological similarity to some alpha/beta hydrolases (53473)
  4. 2923605Superfamily c.144.1: RibA-like [142695] (2 families) (S)
    automatically mapped to Pfam PF00925
  5. 2923606Family c.144.1.1: RibA-like [142696] (1 protein)
    Pfam PF00925; GTP cyclohydrolase II
  6. 2923607Protein GTP cyclohydrolase II, RibA [142697] (1 species)
  7. 2923608Species Escherichia coli [TaxId:562] [142698] (2 PDB entries)
    Uniprot P0A7I7 1-174
  8. 2923611Domain d2bz0b_: 2bz0 B: [129531]
    automated match to d2bz0a1
    complexed with g2p, mg, zn

Details for d2bz0b_

PDB Entry: 2bz0 (more details), 2.6 Å

PDB Description: crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc
PDB Compounds: (B:) GTP cyclohydrolase II

SCOPe Domain Sequences for d2bz0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bz0b_ c.144.1.1 (B:) GTP cyclohydrolase II, RibA {Escherichia coli [TaxId: 562]}
mqlkrvaeaklptpwgdflmvgfeelatghdhvalvygdisghtpvlarvhsecltgdal
fslrcdcgfqleaaltqiaeegrgillyhrqegrnigllnkirayalqdqgydtveanhq
lgfaaderdftlcadmfkllgvnevrlltnnpkkveilteaginivervplivg

SCOPe Domain Coordinates for d2bz0b_:

Click to download the PDB-style file with coordinates for d2bz0b_.
(The format of our PDB-style files is described here.)

Timeline for d2bz0b_: