SCOPe 2.08: Domain d2bz0b_: 2bz0 B:

Lineage for d2bz0b_ (2bz0 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.144: RibA-like [142694] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 1235467, strands 1 and 3 are antiparallel to the rest; partial topological similarity to some alpha/beta hydrolases (53473)

4. Superfamily c.144.1: RibA-like [142695] (2 families)
   automatically mapped to Pfam PF00925

5. Family c.144.1.1: RibA-like [142696] (1 protein)
   Pfam PF00925; GTP cyclohydrolase II

6. Protein GTP cyclohydrolase II, RibA [142697] (1 species)

7. Species Escherichia coli [TaxId:562] [142698] (2 PDB entries)
   Uniprot P0A7I7 1-174

8. Domain d2bz0b_: 2bz0 B: [129531]
   automated match to d2bz0a1
   complexed with g2p, mg, zn

Details for d2bz0b_

PDB Entry: 2bz0, 2.6 Å

PDB Description: crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc

PDB Compounds: (B:) GTP cyclohydrolase II

SCOPe Domain Sequences for d2bz0b_:

Sequence; same for both SEQRES and ATOM records:

>d2bz0b_ c.144.1.1 (B:) GTP cyclohydrolase II, RibA {Escherichia coli [TaxId: 562]}
mqlkrvaeaklptpwgdflmvgfeelatghdhvalvygdisghtpvlarvhsecltgdal
fslrcdcgfqleaaltqiaeegrgillyhrqegrnigllnkirayalqdqgydtveanhq
lgfaaderdftlcadmfkllgvnevrlltnnpkkveilteaginivervplivg

Timeline for d2bz0b_:

• d2bz0b_ first appeared in SCOP 1.73, called d2bz0b1
  
• d2bz0b_ appears in SCOPe 2.07