![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (8 proteins) |
![]() | Protein Beta-ketoacyl-ACP synthase I [53907] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53908] (23 PDB entries) Uniprot P14926 |
![]() | Domain d2byza2: 2byz A:254-406 [129523] automatically matched to d1dd8a2 complexed with dao, nh4; mutant |
PDB Entry: 2byz (more details), 1.95 Å
SCOP Domain Sequences for d2byza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2byza2 c.95.1.1 (A:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgtstpvgdvkelaai revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni vtettdrelttvmsnsfgfggtnatlvmrklkd
Timeline for d2byza2: