Lineage for d2byxb2 (2byx B:254-406)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [254878] (9 PDB entries)
  8. 2524931Domain d2byxb2: 2byx B:254-406 [129509]
    Other proteins in same PDB: d2byxa1, d2byxb1, d2byxc1, d2byxd1
    automated match to d1ek4a2
    complexed with dao, nh4; mutant

Details for d2byxb2

PDB Entry: 2byx (more details), 2 Å

PDB Description: kas i lys328ala mutant in complex with fatty acid
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byxb2 c.95.1.0 (B:254-406) automated matches {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisataamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d2byxb2:

Click to download the PDB-style file with coordinates for d2byxb2.
(The format of our PDB-style files is described here.)

Timeline for d2byxb2: