Lineage for d2bywd1 (2byw D:1-253)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881083Family c.95.1.1: Thiolase-related [53902] (9 protein domains)
  6. 1881471Protein automated matches [231410] (2 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [254877] (6 PDB entries)
  8. 1881476Domain d2bywd1: 2byw D:1-253 [129504]
    Other proteins in same PDB: d2bywa2, d2bywb2, d2bywc2, d2bywd2
    automated match to d2bywa1
    complexed with nh4; mutant

Details for d2bywd1

PDB Entry: 2byw (more details), 1.7 Å

PDB Description: Structure of escherichia coli beta-ketoacyl (acyl carrier protein) synthase I LYS328ALA mutant
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2bywd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bywd1 c.95.1.1 (D:1-253) automated matches {Escherichia coli [TaxId: 562]}
mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d2bywd1:

Click to download the PDB-style file with coordinates for d2bywd1.
(The format of our PDB-style files is described here.)

Timeline for d2bywd1: