SCOPe 2.04: Domain d2bywc2: 2byw C:254-406

Lineage for d2bywc2 (2byw C:254-406)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254878] (8 PDB entries)

8. Domain d2bywc2: 2byw C:254-406 [129503]
   Other proteins in same PDB: d2bywa1, d2bywb1, d2bywc1, d2bywd1
   automated match to d1ek4a2
   complexed with nh4; mutant

Details for d2bywc2

PDB Entry: 2byw, 1.7 Å

PDB Description: structure of escherichia coli beta-ketoacyl (acyl carrier protein) synthase i lys328ala mutant

PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2bywc2:

Sequence; same for both SEQRES and ATOM records:

>d2bywc2 c.95.1.0 (C:254-406) automated matches {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisataamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

Timeline for d2bywc2:

• d2bywc2 first appeared in SCOP 1.73
  
• d2bywc2 appears in SCOPe 2.03
  
• d2bywc2 appears in SCOPe 2.05
  
• d2bywc2 appears in the current release, SCOPe 2.08