Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (45 species) not a true protein |
Domain d2bywc2: 2byw C:254-406 [129503] Other proteins in same PDB: d2bywa1, d2bywb1, d2bywc1, d2bywd1 automated match to d1ek4a2 complexed with nh4; mutant |
PDB Entry: 2byw (more details), 1.7 Å
SCOPe Domain Sequences for d2bywc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bywc2 c.95.1.0 (C:254-406) automated matches {Escherichia coli [TaxId: 562]} yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai revfgdkspaisataamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni vtettdrelttvmsnsfgfggtnatlvmrklkd
Timeline for d2bywc2: